Description

IGF1-LR3 1mg – Long R3 IGF-1 Research Peptide

IGF1-LR3 1mg is an engineered insulin-like growth factor 1 analogue investigated in scientific research involving growth factor signalling, cellular proliferation, protein metabolism and insulin-like growth factor binding proteins. Also known as Long R3 IGF-1, Long Arginine 3 IGF-I or LR3IGF-I, the molecule contains 83 amino acid residues and differs structurally from naturally occurring mature human IGF-1.

IGF1-LR3 1mg is associated with laboratory investigations into the type 1 insulin-like growth factor receptor (IGF-1R), the regulation of growth factor availability and the biological consequences of reduced binding to insulin-like growth factor binding proteins (IGFBPs).

The molecule contains two defining structural modifications: a 13-amino-acid extension at the N-terminus and the replacement of glutamic acid with arginine at position 3 of the IGF-1 region. These changes distinguish IGF1-LR3 from native IGF-1 and the truncated analogue IGF1-DES.

Published experimental studies have reported altered binding protein interactions, changes in cellular growth responses and effects on glucose metabolism in animal models. However, these findings do not establish that IGF1-LR3 1mg safely improves muscle growth, athletic performance, recovery or weight management in humans.

IGF1-LR3 1mg is intended for controlled laboratory research. Human therapeutic effectiveness and long-term safety have not been established.

What Is IGF1-LR3 1mg?

IGF1-LR3 1mg refers to a product labelled as containing 1mg of Long R3 insulin-like growth factor 1.

IGF1-LR3 is an engineered analogue of human IGF-1, a growth factor involved in cellular growth, survival and metabolic signalling.

Mature human IGF-1 contains 70 amino acid residues. IGF1-LR3 contains 83 residues because an additional 13-amino-acid sequence is attached to the N-terminus.

The molecule also contains an arginine residue in place of glutamic acid at position 3 of the IGF-1 region.

These structural modifications were developed to investigate how growth factor activity changes when interactions with IGF-binding proteins are reduced.

IGF1-LR3 is not identical to pharmaceutical recombinant human IGF-1 and should not be treated as an approved medicine.

IGF1-LR3 1mg Product Specifications

• Product Name: IGF1-LR3 1mg
• Scientific Name: Long Arginine 3 Insulin-Like Growth Factor I
• Alternative Names: Long R3 IGF-1, LR3IGF-I, Long-[Arg3]-IGF-I
• Classification: Engineered IGF-1 analogue
• Molecule Type: Recombinant or synthetically produced polypeptide, depending on manufacturer
• Peptide Length: 83 amino acid residues
• N-Terminal Extension: MFPAMPLSSLFVN
• Structural Modification: Arginine replaces glutamic acid at position 3 of the mature IGF-1 region
• Reference Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Reference Molecular Weight: Approximately 9.11 kDa for the correctly oxidised protein
• Commonly Listed CAS Number: 946870-92-4; verify against manufacturer documentation
• Reference Structural Feature: Three intramolecular disulfide bonds
• Primary Research Target: Insulin-like growth factor 1 receptor (IGF-1R)
• Labelled Quantity: 1mg
• Research Category: Growth factor biology and molecular endocrinology
• Research Focus: IGF receptor signalling, IGFBP interactions and cell growth
• Purity: Requires batch-specific verification
• Production Method: Confirm with manufacturer
• Physical Form: Confirm with manufacturer
• Storage: Follow verified manufacturer instructions
• Intended Use: Laboratory research only

The molecular specifications describe the commonly studied Long R3 IGF-1 reference structure. Commercial preparations may differ in formulation, folding state, impurities and analytical characteristics. Product identity and purity require batch-specific verification.

Understanding the Molecular Structure of IGF1-LR3

IGF1-LR3 is an 83-amino-acid analogue derived from human insulin-like growth factor 1.

Its reference sequence is:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

The first 13 residues form an N-terminal extension.

Within the IGF-1-derived region, arginine replaces the glutamic acid normally present at position 3 of mature IGF-1.

The molecule also contains six cysteine residues that form three intramolecular disulfide bonds in the correctly folded reference structure.

These bonds help stabilise the protein’s three-dimensional conformation.

Researchers studying IGF1-LR3 1mg should verify the sequence, expected molecular mass and disulfide-bonded structure.

How Does IGF1-LR3 Work?

IGF1-LR3 acts through insulin-like growth factor signalling pathways in experimental systems.

The IGF-1 receptor is a receptor tyrosine kinase involved in regulating cell growth, survival and metabolism.

Activation of IGF-1R can influence intracellular pathways including PI3K-AKT and MAPK signalling.

IGF1-LR3 retains IGF-related receptor activity while displaying substantially reduced affinity for several IGF-binding proteins.

These binding proteins normally regulate the distribution and availability of circulating and tissue-associated IGF molecules.

Reduced IGFBP binding can change experimental growth factor activity and clearance.

However, lower binding protein affinity does not automatically produce a longer circulating half-life. Published animal research reported faster plasma clearance of LR3IGF-I compared with native IGF-I under certain conditions.

IGF1-LR3 should therefore not be described as having a universally established prolonged human half-life.

Scientific Research Into IGF1-LR3 1mg

1. IGF1-LR3 1mg and IGF-1 Receptor Research

The type 1 insulin-like growth factor receptor participates in cellular growth, survival and metabolic signalling.

IGF1-LR3 has been investigated as an engineered ligand of this receptor system.

Researchers have compared receptor-related activity between native IGF-1 and modified analogues.

These comparisons help clarify how molecular changes influence growth factor behaviour.

However, receptor activity alone does not establish therapeutic effectiveness or safety in humans.

2. IGF1-LR3 and IGF-Binding Protein Research

Insulin-like growth factor binding proteins regulate the distribution and biological availability of IGF molecules.

IGF1-LR3 has substantially reduced binding affinity for several IGFBPs compared with native IGF-1.

A published animal and cell study reported approximately 1,000-fold lower affinity for selected binding proteins, including IGFBP-3 and IGFBP-4, under the experimental conditions examined.

This property is central to the compound’s use in growth factor research.

However, the exact degree of reduced binding varies according to the protein and experimental system.

3. IGF1-LR3 1mg and Cellular Proliferation

Cellular proliferation is the process through which cells grow and divide.

IGF receptor signalling participates in proliferation in multiple cell types.

Research involving cultured L6 myoblasts reported stronger biological responses to LR3IGF-I than to native IGF-I under selected conditions.

The difference was associated partly with reduced interaction with IGF-binding proteins.

These observations concern laboratory cell systems and do not establish safe muscle growth in humans.

4. IGF1-LR3 and Skeletal Muscle Research

Skeletal muscle growth and maintenance involve mechanical loading, nutrition, endocrine regulation and local signalling pathways.

IGF-related signalling has been investigated in muscle cell proliferation and differentiation.

IGF1-LR3 has been used in experimental muscle-related research to examine the effects of altered growth factor availability.

However, results from cultured cells and animal models cannot establish that IGF1-LR3 1mg safely increases human muscle mass or strength.

5. IGF1-LR3 1mg and Protein Metabolism

Protein metabolism includes protein synthesis, breakdown and turnover.

IGF-related pathways participate in the regulation of these processes.

Animal research involving LR3IGF-I reported changes in nitrogen retention and growth-related measurements.

However, such results depend on the experimental species and conditions.

They do not establish predictable benefits in humans.

6. IGF1-LR3 and PI3K-AKT Signalling

The PI3K-AKT signalling pathway participates in cellular growth, metabolism and survival.

IGF-1 receptor activation can influence this pathway.

IGF1-LR3 is relevant to laboratory investigations of receptor-mediated signalling.

However, pathway activation is not equivalent to demonstrating a beneficial therapeutic outcome.

7. IGF1-LR3 1mg and MAPK Signalling

MAPK signalling pathways contribute to cellular responses involving proliferation and differentiation.

IGF receptor activity can influence these pathways.

Researchers may investigate IGF1-LR3-associated changes in phosphorylation and related molecular markers.

The resulting biological effects depend on the experimental system and cell type.

8. IGF1-LR3 and Growth Factor Bioavailability

Growth factor bioavailability depends partly on interactions with binding proteins.

Native IGF-1 circulates in association with IGF-binding proteins and other components.

IGF1-LR3 has reduced affinity for several IGFBPs.

This can increase biological activity in selected laboratory assays.

However, animal research also demonstrates that reduced binding may accelerate plasma clearance.

Therefore, greater in vitro potency does not automatically imply prolonged circulation in humans.

9. IGF1-LR3 1mg and Blood Glucose Research

IGF-related signalling can influence glucose metabolism.

Animal studies involving IGF-1 variants, including LR3IGF-I, have reported reductions in blood glucose.

These findings demonstrate that the molecule can have important metabolic effects.

However, glucose lowering is not evidence of safe treatment for diabetes or obesity.

Excessive glucose reduction may produce serious adverse effects.

10. IGF1-LR3 and Hypoglycaemia Research

Hypoglycaemia refers to abnormally low blood glucose.

Severe hypoglycaemia can cause confusion, seizures, loss of consciousness and other medical emergencies.

Research involving pigs reported that several IGF-1 variants had stronger glucose-lowering effects than native IGF-1.

LR3IGF-I was among the analogues investigated.

These findings highlight a significant safety concern associated with the biological activity of the compound.

11. IGF1-LR3 1mg and Plasma Clearance Research

Plasma clearance describes the removal of a compound from the bloodstream.

IGF-binding proteins can influence the circulation and distribution of IGF molecules.

A published animal study reported that LR3IGF-I was cleared from plasma more rapidly than native IGF-I.

The difference was associated with reduced binding protein interactions.

Researchers should distinguish plasma clearance from the duration of biological effects in tissues.

12. IGF1-LR3 and Animal Growth Research

Animal studies have investigated how modified IGF-1 molecules influence growth-related measurements.

Research involving rats reported changes in body weight, nitrogen retention and food conversion efficiency following experimental LR3IGF-I exposure.

However, these findings cannot establish safe or effective growth enhancement in humans.

Species differences and experimental conditions limit direct clinical interpretation.

13. IGF1-LR3 1mg and IGF-1 Structure-Activity Relationships

Structure-activity relationship research investigates how molecular modifications influence biological properties.

IGF1-LR3 contains a 13-residue N-terminal extension and an arginine substitution.

These changes substantially affect interactions with IGF-binding proteins.

Researchers can compare IGF1-LR3 with native IGF-1 and other variants to investigate the role of individual molecular regions.

14. IGF1-LR3 and Protein Folding Research

Correct protein folding is important for receptor interactions and biological activity.

IGF1-LR3 contains three disulfide bonds in its reference structure.

Incorrect folding, aggregation or oxidation may alter experimental behaviour.

Researchers should therefore verify relevant structural and analytical characteristics when evaluating IGF1-LR3 1mg.

15. IGF1-LR3 1mg and Research Reproducibility

Reliable scientific research depends on accurately identified materials.

Variations in amino acid sequence, purity, formulation and protein folding can influence experimental results.

IGF1-LR3 1mg should be evaluated using batch-specific documentation and appropriate analytical methods.

Researchers should distinguish the compound from native IGF-1, IGF1-DES and other engineered analogues.

IGF1-LR3 1mg vs Native IGF-1

IGF1-LR3 and native human IGF-1 are related but chemically distinct molecules.

• IGF1-LR3: Contains 83 amino acid residues.
• Native IGF-1: Contains 70 amino acid residues.
• N-Terminal Extension: IGF1-LR3 contains an additional 13 residues.
• Position 3: IGF1-LR3 contains arginine instead of glutamic acid.
• IGFBP Binding: IGF1-LR3 has reduced affinity for several binding proteins.
• Research Interpretation: Differences in experimental potency do not establish improved clinical safety.

IGF1-LR3 1mg vs IGF1-DES

IGF1-LR3 and IGF1-DES are different modified IGF-1 molecules.

IGF1-LR3 is an 83-residue analogue with an N-terminal extension and arginine substitution.

IGF1-DES is a 67-residue variant lacking the first three amino acids of mature IGF-1.

Both have been investigated for altered binding protein interactions.

However, their molecular structures, experimental activity and pharmacokinetic properties differ.

Research findings involving IGF1-DES should not automatically be attributed to IGF1-LR3.

IGF1-LR3 1mg vs Mecasermin

Mecasermin is a pharmaceutical preparation of recombinant human IGF-1 used for specific approved medical indications.

IGF1-LR3 is an engineered analogue with a different molecular structure.

The clinical approval of mecasermin does not establish approval or safety for IGF1-LR3.

Clinical prescribing information for mecasermin should not be applied to research-grade IGF1-LR3.

IGF1-LR3 1mg and Muscle Growth Claims

IGF1-LR3 1mg is sometimes discussed online in relation to muscle growth and athletic performance.

However, there is insufficient reliable human clinical evidence demonstrating that IGF1-LR3 safely increases muscle mass, strength or recovery.

Cell culture and animal growth findings cannot establish these outcomes in humans.

IGF1-LR3 should not be marketed as a proven muscle-building treatment.

IGF1-LR3 1mg and Weight Management

IGF1-LR3 1mg is not an established weight-loss treatment.

Although IGF-related signalling participates in metabolic regulation, the compound has not been demonstrated to safely produce clinically meaningful fat reduction in humans.

Its glucose-lowering effects in animal research represent an important safety consideration rather than proof of obesity-treatment effectiveness.

Understanding the IGF1-LR3 1mg Label

The 1mg designation refers to the labelled quantity of research material.

It does not represent a recommended human dose or independently establish molecular identity, purity, sterility or biological activity.

Researchers should verify the labelled mass and the relevant batch documentation.

IGF1-LR3 1mg Research Quality and Documentation

Important considerations when evaluating IGF1-LR3 1mg include:

• Verification of the complete 83-amino-acid sequence
• Confirmation of the 13-residue N-terminal extension
• Verification of the arginine substitution in the IGF-1 region
• Confirmation of the expected molecular mass
• Assessment of the three disulfide bonds
• Evaluation of protein folding and aggregation
• Batch-specific certificate of analysis
• Appropriate analytical purity testing
• Mass spectrometry or another suitable identity method
• Confirmation of the labelled 1mg quantity
• Assessment of production-related impurities
• Manufacturer and batch traceability
• Documentation of formulation components
• Product-specific storage and stability information
• Clearly stated research-use classification

Storage and Handling of IGF1-LR3 1mg

IGF1-LR3 1mg should be stored according to verified manufacturer instructions.

Storage requirements depend on formulation, physical presentation, packaging and protein stability.

Researchers should not assume that all IGF1-LR3 preparations have identical storage requirements or shelf lives.

Laboratory handling should follow institutional procedures and relevant safety documentation.

IGF1-LR3 1mg Safety and Scientific Limitations

IGF1-LR3 1mg is an investigational research material without an established human clinical safety profile.

Animal studies have reported substantial glucose-lowering effects with LR3IGF-I and related IGF-1 variants.

Potential safety concerns include hypoglycaemia, unintended growth factor signalling and unknown long-term effects.

Because IGF-1 receptor signalling is involved in cellular growth and survival, possible effects on proliferating tissues also require careful investigation.

There is insufficient reliable evidence demonstrating safe and effective human use for muscle growth, athletic performance, recovery, weight management or anti-ageing.

IGF1-LR3 is not an established approved UK medicine for these purposes.

Research-grade material should not be assumed suitable for human administration.

The labelled 1mg quantity is not a human dosing recommendation.

Frequently Asked Questions About IGF1-LR3 1mg

What is IGF1-LR3 1mg?

IGF1-LR3 1mg is a product listing for an engineered 83-amino-acid analogue of insulin-like growth factor 1 with a labelled quantity of 1mg.

What does LR3 mean in IGF1-LR3?

LR3 refers to Long Arginine 3, describing the N-terminal extension and arginine substitution in the IGF-1 region.

How many amino acids does IGF1-LR3 contain?

IGF1-LR3 contains 83 amino acid residues.

What is the IGF1-LR3 peptide sequence?

The commonly referenced sequence is MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA.

What is the molecular weight of IGF1-LR3?

The reference molecular weight is approximately 9.11 kDa for the correctly oxidised molecule.

What is the CAS number for IGF1-LR3?

A commonly listed CAS number is 946870-92-4, although the identifier should be verified against manufacturer documentation.

Is IGF1-LR3 the same as IGF1-DES?

No. IGF1-LR3 contains 83 residues, while IGF1-DES contains 67 residues and lacks the first three amino acids of mature IGF-1.

Does IGF1-LR3 bind to IGF-binding proteins?

It has substantially reduced affinity for several IGF-binding proteins compared with native IGF-1.

Does IGF1-LR3 have a longer half-life?

A prolonged human half-life has not been reliably established. Some animal studies reported faster plasma clearance than native IGF-1.

Does IGF1-LR3 stimulate cell growth?

Selected laboratory studies reported increased cellular growth responses, but these findings do not establish safe tissue growth in humans.

Does IGF1-LR3 lower blood glucose?

Animal studies reported significant glucose-lowering activity, raising concerns about hypoglycaemia.

Does IGF1-LR3 build muscle?

There is insufficient reliable human clinical evidence demonstrating safe increases in muscle mass or strength.

Is IGF1-LR3 a weight-loss peptide?

No. IGF1-LR3 is not an established obesity or weight-management treatment.

Is IGF1-LR3 approved for human use?

IGF1-LR3 is not an established approved UK medicine for muscle growth, weight loss or anti-ageing.

What does IGF1-LR3 1mg mean?

The designation refers to a labelled quantity of 1mg of research material, not a recommended human dose.

IGF1-LR3 1mg – Scientific Product Summary

IGF1-LR3 1mg is an engineered 83-amino-acid analogue of human insulin-like growth factor 1.

Its defining features are a 13-residue N-terminal extension and an arginine substitution at position 3 of the IGF-1 region.

Published research has examined IGF1-LR3 in relation to growth factor receptor signalling, IGF-binding proteins, cellular proliferation, protein metabolism and glucose regulation.

However, human therapeutic effectiveness and long-term safety remain insufficiently established.

Researchers evaluating IGF1-LR3 1mg should verify molecular identity, protein folding, purity, formulation, labelled quantity and batch-specific analytical documentation.